Home  >  Products  >  anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) (Middle Region) antibody
anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) (Middle Region) antibody

anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) (Middle Region) antibody

Cat no: ABIN310701

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) (Middle Region) antibody: This is a rabbit polyclonal antibody against NR1H2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310701
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 7376,610057,509622,100462688,22260,58851
Concentration: 1 mg/mL
Antigen: NR1H2
Clonality: Polyclonal
Sequence: MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQ RFAHFTELAI
Molecular weight: 51 kDa
Entrez gene: 7376,610057,509622,100462688,22260,58851

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave