Home  >  Products  >  anti-Nuclear Receptor Subfamily 1, Group H, Member 3 (NR1H3) (N-Term) antibody
anti-Nuclear Receptor Subfamily 1, Group H, Member 3 (NR1H3) (N-Term) antibody

anti-Nuclear Receptor Subfamily 1, Group H, Member 3 (NR1H3) (N-Term) antibody

Cat no: ABIN183689

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nuclear Receptor Subfamily 1, Group H, Member 3 (NR1H3) (N-Term) antibody: This is a rabbit polyclonal antibody against NR1H3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183689
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 10062,483625,507176,100352900
Concentration: 1 mg/mL
Antigen: NR1H3
Clonality: Polyclonal
Sequence: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCIL REEARMPHSA
Molecular weight: 50 kDa
Entrez gene: 10062,483625,507176,100352900

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave