Home  >  Products  >  anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (C-Term) antibody
anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (C-Term) antibody

anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (C-Term) antibody

Cat no: ABIN183812

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (C-Term) antibody: This is a rabbit polyclonal antibody against NR1I2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183812
Reactivities: Human, Mouse, Rat, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 8856,403482,397228,493713,18171,84385
Concentration: 1 mg/mL
Antigen: NR1I2
Clonality: Polyclonal
Sequence: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFA TPLMQELFGI
Molecular weight: 54 kDa
Entrez gene: 8856,403482,397228,493713,18171,84385

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave