Home  >  Products  >  anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (N-Term) antibody

anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (N-Term) antibody

Cat no: ABIN405044


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Nuclear Receptor Subfamily 1, Group I, Member 2 (NR1I2) (N-Term) antibody: This is a rabbit polyclonal antibody against NR1I2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405044
Reactivities: Human
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Accession: O75469
Gene: 8856
Concentration: 1 mg/mL
Antigen: NR1I2
Clonality: Polyclonal
Sequence: KKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQ RMMIRELMDA
Molecular weight: 50 kDa
Entrez gene: 8856

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave