Home  >  Products  >  anti-Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody
anti-Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody

anti-Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody

Cat no: ABIN183439

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3) (C-Term) antibody: This is a rabbit polyclonal antibody against NR1I3. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183439
Reactivities: Mouse
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Accession: O35627
Gene: 12355
Concentration: 1 mg/mL
Antigen: NR1I3
Clonality: Polyclonal
Sequence: QQSRLQSRFLYAKLMGLLADLRSINNAYSYELQRLEELSA MTPLLGEICS
Molecular weight: 39 kDa
Entrez gene: 12355

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave