Home  >  Products  >  anti-Nuclear Receptor Subfamily 2, Group E, Member 3 (NR2E3) (N-Term) antibody
anti-Nuclear Receptor Subfamily 2, Group E, Member 3 (NR2E3) (N-Term) antibody

anti-Nuclear Receptor Subfamily 2, Group E, Member 3 (NR2E3) (N-Term) antibody

Cat no: ABIN183753

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nuclear Receptor Subfamily 2, Group E, Member 3 (NR2E3) (N-Term) antibody: This is a rabbit polyclonal antibody against NR2E3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183753
Reactivities: Human, Mouse, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 10002,281944,23958
Concentration: 1 mg/mL
Antigen: NR2E3
Clonality: Polyclonal
Sequence: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTG VSPSLQCRVC
Molecular weight: 45 kDa
Entrez gene: 10002,281944,23958

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave