Home  >  Products  >  anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody

anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody

Cat no: ABIN183842

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Nucleus Accumbens Associated 1, BEN and BTB (POZ) Domain Containing (NACC1) (C-Term) antibody: This is a rabbit polyclonal antibody against BTBD14B. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183842
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 112939,484918,525378,66830,171454
Concentration: 1 mg/mL
Antigen: BTBD14B
Clonality: Polyclonal
Sequence: WMPKVKVLKAEDDAYTTFISETGKIEPDMMGVEHGFETAS HEGEAGPSAE
Molecular weight: 57 kDa
Entrez gene: 112939,484918,525378,66830,171454

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave