Home  >  Products  >  anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) (C-Term) antibody

anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) (C-Term) antibody

Cat no: ABIN406025


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) (C-Term) antibody: This is a rabbit polyclonal antibody against NUDT18. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406025
Reactivities: Human, Mouse, Rat
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 79873,213484,361068
Concentration: 1 mg/mL
Antigen: NUDT18
Clonality: Polyclonal
Sequence: KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVR GENFSWWKVM
Molecular weight: 35 kDa
Entrez gene: 79873,213484,361068

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave