Home  >  Products  >  anti-Olfactomedin-Like 2A (OLFML2A) (N-Term) antibody
anti-Olfactomedin-Like 2A (OLFML2A) (N-Term) antibody

anti-Olfactomedin-Like 2A (OLFML2A) (N-Term) antibody

Cat no: ABIN406349

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Olfactomedin-Like 2A (OLFML2A) (N-Term) antibody: This is a rabbit polyclonal antibody against OLFML2A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406349
Reactivities: Human, Mouse, Rat, Bovine, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100002223,398693,169611,100154062,516730,241327,296708
Concentration: 1 mg/mL
Antigen: OLFML2A
Clonality: Polyclonal
Sequence: EDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKK QAPELLKLQS
Molecular weight: 73 kDa
Entrez gene: 100002223,398693,169611,100154062,516730,241327,296708

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave