Home  >  Products  >  anti-ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1) (Middle Region) antibody

anti-ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1) (Middle Region) antibody

Cat no: ABIN311247


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1) (Middle Region) antibody: This is a rabbit polyclonal antibody against ORAI1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311247
Reactivities: Human, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 84876,486261,100154923,517688
Concentration: 1 mg/mL
Antigen: ORAI1
Clonality: Polyclonal
Sequence: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAA ANVSTSGITP
Molecular weight: 33 kDa
Entrez gene: 84876,486261,100154923,517688

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave