Home  >  Products  >  anti-Par-6 Partitioning Defective 6 Homolog beta (C. Elegans) (PARD6B) (N-Term) antibody
anti-Par-6 Partitioning Defective 6 Homolog beta (C. Elegans) (PARD6B) (N-Term) antibody

anti-Par-6 Partitioning Defective 6 Homolog beta (C. Elegans) (PARD6B) (N-Term) antibody

Cat no: ABIN405503

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Par-6 Partitioning Defective 6 Homolog beta (C. Elegans) (PARD6B) (N-Term) antibody: This is a rabbit polyclonal antibody against PARD6B. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405503
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100124652,398165,419352,84612,485926,539687,58220,362279
Concentration: 1 mg/mL
Antigen: PARD6B
Clonality: Polyclonal
Sequence: MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKF EEFYGLLQHV
Molecular weight: 41 kDa
Entrez gene: 100124652,398165,419352,84612,485926,539687,58220,362279

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave