Home  >  Products  >  anti-PC4 and SFRS1 Interacting Protein 1 (PSIP1) (Middle Region) antibody

anti-PC4 and SFRS1 Interacting Protein 1 (PSIP1) (Middle Region) antibody

Cat no: ABIN183058


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-PC4 and SFRS1 Interacting Protein 1 (PSIP1) (Middle Region) antibody: This is a rabbit polyclonal antibody against PSIP1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183058
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 11168,474712,101739,313323
Concentration: 1 mg/mL
Antigen: PSIP1
Clonality: Polyclonal
Sequence: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDS RLQRIHAEIK
Molecular weight: 60 kDa
Entrez gene: 11168,474712,101739,313323

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave