logo
logo
anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody

Cat no: ABIN183998

anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody

anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody: This is a rabbit polyclonal antibody against PPIE. It was validated on Western Blot using a cell lysate as a positive control.

Prices direct from Antibodies-online

Quick response times

Exclusive Biosave savings/discounts

SPECIFICATIONS

Catalog Number

ABIN183998

Size

100 micro g

Applications

WB

Hosts

Rabbit

Reactivities

Hum, Mouse, Rat, Can, Dro/Arth, ZF/Fish

Antigen

PPIE

Gene Id

550373,10450,607232,56031,298508

Sequence

RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTG PGLLSMANSG

Clonality

Polyclonal

Concentration

1 mg/mL

Entrez Gene Id

550373,10450,607232,56031,298508

Molecular Weight

26 kDa

Read more on Supplier website

Latest promotions

Spend less time on DNA cleanup so you can do more science. The MSB Spin PCRapace is the fastest way to purify your DNA from PCR, restriction digestion, and...

Genovis introduces GlycINATOR™• Works on most IgGs• Effective on high-mannose and bisected N-linked Fc-glycans • Rapid – 30-minute...

Use promo code EASY3 to receive 13% off and FREE shipping!Experience a new dimension of electronic pipetting with the NEW Easypet 3 pipette controller. The...

New brilliant antibodies, and new lower prices!For flow cytometry reagents in general, \"bright is better.\" The violet-excitable BD Horizon™ BV421 and...

As an incentive to qualify our BSA, we are offering a 20% discount when you purchase your first 100g, 500g or 1000g of any grade of Bovine Serum Albumin....

It is not every day that you are given something for nothing. We are giving away additional spectrophotometer software.Cecil Instruments have enhanced the...

Did your supplier increase the price of Fetal Bovine Serum? Did they substitute the US Origin with USDA? Well say no more! Innovative Research is still...

We're so sure that you'll prefer Cayman Assay kits over your present brand that we're willing to give you a free assay kit to prove it!

10% Discount on 2 Rabbit Polyclonal Antibody Service. With over 20 years experience, SDIX has developed into the premier US custom antibody producer,...

For the past decade scientists have extensively used ATS secondary toxin conjugates to make their own targeted toxins for in vitro use.The ability to combine...

Bulk Cytokines with Custom Vialing.20 - 50% off cytokines, growth factors, chemokines and more...For a limited time Cell Sciences is offering substantial...

Jenway’s 73 series spectrophotometer range provides four models with a narrow spectral bandwidth of 5nm and an absorbance range of –0.3 to 2.5A,...

Are you planning to have a customised antibody made for your research?Since 2000, Everest has been producing a catalog containing thousands of affinity...