Home  >  Products  >  anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody
anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody

anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody

Cat no: ABIN183999

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Peptidylprolyl Isomerase E (Cyclophilin E) (PPIE) (Middle Region) antibody: This is a rabbit polyclonal antibody against PPIE. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183999
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 10450,607232,787681,56031,298508
Concentration: 1 mg/mL
Antigen: PPIE
Clonality: Polyclonal
Sequence: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQV YMDIKIGNKP
Molecular weight: 33 kDa
Entrez gene: 10450,607232,787681,56031,298508

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave