Home  >  Products  >  anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) (Middle Region) antibody

anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) (Middle Region) antibody

Cat no: ABIN310287


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) (Middle Region) antibody: This is a rabbit polyclonal antibody against PPAP2A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310287
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 735106,427138,8611,617172,19012,64369
Concentration: 1 mg/mL
Antigen: PPAP2A
Clonality: Polyclonal
Sequence: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSF SMYCMLFVAL
Molecular weight: 31 kDa
Entrez gene: 735106,427138,8611,617172,19012,64369

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave