Home  >  Products  >  anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class O (PIGO) (N-Term) antibody

anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class O (PIGO) (N-Term) antibody

Cat no: ABIN311245


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class O (PIGO) (N-Term) antibody: This is a rabbit polyclonal antibody against PIGO. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311245
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 84720,474754,783989,56703,313341
Concentration: 1 mg/mL
Antigen: PIGO
Clonality: Polyclonal
Sequence: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEI QPHHARLYRS
Molecular weight: 74 kDa
Entrez gene: 84720,474754,783989,56703,313341

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave