Home  >  Products  >  anti-Pleckstrin and Sec7 Domain Containing 3 (PSD3) (Middle Region) antibody
anti-Pleckstrin and Sec7 Domain Containing 3 (PSD3) (Middle Region) antibody

anti-Pleckstrin and Sec7 Domain Containing 3 (PSD3) (Middle Region) antibody

Cat no: ABIN310338

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Pleckstrin and Sec7 Domain Containing 3 (PSD3) (Middle Region) antibody: This is a rabbit polyclonal antibody against PSD3. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310338
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 770334,23362,606759,531459,234353,306380
Concentration: 1 mg/mL
Antigen: PSD3
Clonality: Polyclonal
Sequence: SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFF KAFSLVGETQ
Molecular weight: 56 kDa
Entrez gene: 770334,23362,606759,531459,234353,306380

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave