Home  >  Products  >  anti-Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3) (C-Term) antibody
anti-Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3) (C-Term) antibody

anti-Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3) (C-Term) antibody

Cat no: ABIN182875

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Poly (ADP-Ribose) Polymerase Family, Member 3 (PARP3) (C-Term) antibody: This is a rabbit polyclonal antibody against PARP3. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN182875
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 10039,507426,235587,300985
Concentration: 1 mg/mL
Antigen: PARP3
Clonality: Polyclonal
Sequence: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTEL ELDGQQVVVP
Molecular weight: 59 kDa
Entrez gene: 10039,507426,235587,300985

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave