Home  >  Products  >  anti-Polyamine Modulated Factor 1 (PMF1) (N-Term) antibody
anti-Polyamine Modulated Factor 1 (PMF1) (N-Term) antibody

anti-Polyamine Modulated Factor 1 (PMF1) (N-Term) antibody

Cat no: ABIN309920

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Polyamine Modulated Factor 1 (PMF1) (N-Term) antibody: This is a rabbit polyclonal antibody against PMF1. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN309920
Reactivities: Human, Mouse, Bovine, Canine, Porcine
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 11243,612152,100144449,616311,67037
Concentration: 1 mg/mL
Antigen: PMF1
Clonality: Polyclonal
Sequence: MVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQRIYDKF IAQLQTSIRE
Molecular weight: 19 kDa
Entrez gene: 11243,612152,100144449,616311,67037

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave