Home  >  Products  >  anti-Polycystic Kidney Disease (Polycystin) and REJ Homolog (Sperm Receptor For Egg Jelly Homolog, Sea Urchin) (PKDREJ) (Middle Region) antibody

anti-Polycystic Kidney Disease (Polycystin) and REJ Homolog (Sperm Receptor For Egg Jelly Homolog, Sea Urchin) (PKDREJ) (Middle Region) antibody

Cat no: ABIN404982


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Polycystic Kidney Disease (Polycystin) and REJ Homolog (Sperm Receptor For Egg Jelly Homolog, Sea Urchin) (PKDREJ) (Middle Region) antibody: This is a rabbit polyclonal antibody against PKDREJ. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404982
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q9NTG1
Gene: 10343
Concentration: 1 mg/mL
Antigen: PKDREJ
Clonality: Polyclonal
Sequence: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEV DGSLKKTTGG
Molecular weight: 254 kDa
Entrez gene: 10343

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave