Home  >  Products  >  anti-Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K) (Middle Region) antibody
anti-Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K) (Middle Region) antibody

anti-Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K) (Middle Region) antibody

Cat no: ABIN406007

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K) (Middle Region) antibody: This is a rabbit polyclonal antibody against POLR2K. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406007
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 796803,768387,5440,614776,17749,309224
Concentration: 1 mg/mL
Antigen: POLR2K
Clonality: Polyclonal
Sequence: DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGY RIMYKKRTKR
Molecular weight: 7 kDa
Entrez gene: 796803,768387,5440,614776,17749,309224

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave