Home  >  Products  >  anti-Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F) (N-Term) antibody
anti-Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F) (N-Term) antibody

anti-Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F) (N-Term) antibody

Cat no: ABIN502973

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F) (N-Term) antibody: This is a rabbit polyclonal antibody against POLR3F. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502973
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 10621,477143,529410,70408,311487
Concentration: 1 mg/mL
Antigen: POLR3F
Clonality: Polyclonal
Sequence: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQN EMPHIEAQQR
Molecular weight: 36 kDa
Entrez gene: 10621,477143,529410,70408,311487

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave