Home  >  Products  >  anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2) (Middle Region) antibody

anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2) (Middle Region) antibody

Cat no: ABIN183543


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2) (Middle Region) antibody: This is a rabbit polyclonal antibody against KCNAB2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183543
Reactivities: Human, Mouse, Rat, Canine, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 797337,8514,489626,16498,29738
Concentration: 1 mg/mL
Antigen: KCNAB2
Clonality: Polyclonal
Sequence: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRP DPNTPMEETV
Molecular weight: 40 kDa
Entrez gene: 797337,8514,489626,16498,29738

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave