Home  >  Products  >  anti-Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3) (Middle Region) antibody
anti-Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3) (Middle Region) antibody

anti-Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3) (Middle Region) antibody

Cat no: ABIN404981

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 3 (KCNC3) (Middle Region) antibody: This is a rabbit polyclonal antibody against KCNC3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404981
Reactivities: Human, Mouse, Rat, Bovine, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 779437,3748,617852,100009368,16504,117101
Concentration: 1 mg/mL
Antigen: KCNC3
Clonality: Polyclonal
Sequence: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYG DMYPKTWSGM
Molecular weight: 80 kDa
Entrez gene: 779437,3748,617852,100009368,16504,117101

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave