Home  >  Products  >  anti-Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4) (N-Term) antibody
anti-Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4) (N-Term) antibody

anti-Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4) (N-Term) antibody

Cat no: ABIN404999

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4) (N-Term) antibody: This is a rabbit polyclonal antibody against KCNG4. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN404999
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: Q8TDN1
Gene: 93107
Concentration: 1 mg/mL
Antigen: KCNG4
Clonality: Polyclonal
Sequence: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDV LRQQRETRRP
Molecular weight: 59 kDa
Entrez gene: 93107

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave