Home  >  Products  >  anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5) (N-Term) antibody
anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5) (N-Term) antibody

anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5) (N-Term) antibody

Cat no: ABIN183181

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 5 (KCNH5) (N-Term) antibody: This is a rabbit polyclonal antibody against KCNH5. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183181
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 50 micro g
Gene: 100331767,423514,27133,490724,537813,238271,171146
Concentration: 1 mg/mL
Antigen: KCNH5
Clonality: Polyclonal
Sequence: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQY KQEAPKTPPH
Molecular weight: 67 kDa
Entrez gene: 100331767,423514,27133,490724,537813,238271,171146

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave