Home  >  Products  >  anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (C-Term) antibody
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (C-Term) antibody

anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (C-Term) antibody

Cat no: ABIN182575

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (C-Term) antibody: This is a rabbit polyclonal antibody against PSMD14. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182575
Reactivities: Human, Mouse, Rat, Bovine, Drosophila/Arthropod, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 799058,444285,10213,535683,59029,311078
Concentration: 1 mg/mL
Antigen: PSMD14
Clonality: Polyclonal
Sequence: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL AAMLDTVVFK
Molecular weight: 35 kDa
Entrez gene: 799058,444285,10213,535683,59029,311078

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave