Home  >  Products  >  anti-Protein Arginine Methyltransferase 3 (PRMT3) (Middle Region) antibody
anti-Protein Arginine Methyltransferase 3 (PRMT3) (Middle Region) antibody

anti-Protein Arginine Methyltransferase 3 (PRMT3) (Middle Region) antibody

Cat no: ABIN405308

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Protein Arginine Methyltransferase 3 (PRMT3) (Middle Region) antibody: This is a rabbit polyclonal antibody against PRMT3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN405308
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: ChIP, Immunoprecipitation, Western Blot
Size: 50 micro g
Gene: 10196,476887,523174,71974,89820
Concentration: 1 mg/mL
Antigen: PRMT3
Clonality: Polyclonal
Sequence: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFST GPQSTKTHWK
Molecular weight: 60 kDa
Entrez gene: 10196,476887,523174,71974,89820

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave