Home  >  Products  >  anti-Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1) (Middle Region) antibody

anti-Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1) (Middle Region) antibody

Cat no: ABIN487251


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1) (Middle Region) antibody: This is a rabbit polyclonal antibody against PRKAA1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN487251
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100001198,495290,427185,5562,479351,100145903,540404,105787,65248
Concentration: 1 mg/mL
Antigen: PRKAA1
Clonality: Polyclonal
Sequence: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPE DPSYSSTMID
Molecular weight: 63 kDa
Entrez gene: 100001198,495290,427185,5562,479351,100145903,540404,105787,65248

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave