Home  >  Products  >  anti-Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (N-Term) antibody
anti-Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (N-Term) antibody

anti-Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (N-Term) antibody

Cat no: ABIN501973

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (N-Term) antibody: This is a rabbit polyclonal antibody against PRKRA. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501973
Reactivities: Human, Mouse, Rat, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 8575,488423,282875,23992,311130
Concentration: 1 mg/mL
Antigen: PRKRA
Clonality: Polyclonal
Sequence: MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLH EYGMKTKNIP
Molecular weight: 34 kDa
Entrez gene: 8575,488423,282875,23992,311130

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave