Home  >  Products  >  anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A) (Middle Region) antibody
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A) (Middle Region) antibody

anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A) (Middle Region) antibody

Cat no: ABIN504354

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A) (Middle Region) antibody: This is a rabbit polyclonal antibody against PPM1A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN504354
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100003481,380058,423525,5494,480344,281994,100009431,19042,24666
Concentration: 1 mg/mL
Antigen: PPM1A
Clonality: Polyclonal
Sequence: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGD SRGLLCRNRK
Molecular weight: 36 kDa
Entrez gene: 100003481,380058,423525,5494,480344,281994,100009431,19042,24666

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave