Home  >  Products  >  anti-Protocadherin 1 (PCDH1) (N-Term) antibody
anti-Protocadherin 1 (PCDH1) (N-Term) antibody

anti-Protocadherin 1 (PCDH1) (N-Term) antibody

Cat no: ABIN502613

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Protocadherin 1 (PCDH1) (N-Term) antibody: This is a rabbit polyclonal antibody against PCDH1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502613
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Immunocytochemistry, Western Blot
Size: 50 micro g
Gene: 100191020,416194,5097,487189,509388,75599,307481
Concentration: 1 mg/mL
Antigen: PCDH1
Clonality: Polyclonal
Sequence: LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSL AADYGFPDVG
Molecular weight: 111 kDa
Entrez gene: 100191020,416194,5097,487189,509388,75599,307481

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave