Home  >  Products  >  anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody
anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody

anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody

Cat no: ABIN310286

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1) (N-Term) antibody: This is a rabbit polyclonal antibody against PPFIBP1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310286
Reactivities: Human, Mouse, Rat, Canine, Chicken/Bird, Drosophila/Arthropod, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 100329686,398525,418219,8496,486623,67533,312855
Concentration: 1 mg/mL
Antigen: PPFIBP1
Clonality: Polyclonal
Sequence: PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAE TLVEWLQSQM
Molecular weight: 19 kDa
Entrez gene: 100329686,398525,418219,8496,486623,67533,312855

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave