Home  >  Products  >  anti-Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6) (N-Term) antibody
anti-Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6) (N-Term) antibody

anti-Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6) (N-Term) antibody

Cat no: ABIN183140

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Purinergic Receptor P2X, Ligand-Gated Ion Channel, 6 (P2RX6) (N-Term) antibody: This is a rabbit polyclonal antibody against P2RXL1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183140
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 9127,486436,618262,18440,25041
Concentration: 1 mg/mL
Antigen: P2RXL1
Clonality: Polyclonal
Sequence: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQ GENVFFLVTN
Molecular weight: 47 kDa
Entrez gene: 9127,486436,618262,18440,25041

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave