Home  >  Products  >  anti-Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1) (Middle Region) antibody
anti-Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1) (Middle Region) antibody

anti-Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1) (Middle Region) antibody

Cat no: ABIN502258

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Ral GEF with PH Domain and SH3 Binding Motif 1 (RALGPS1) (Middle Region) antibody: This is a rabbit polyclonal antibody against RALGPS1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502258
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100101642,417089,9649,616166,241308,100361774
Concentration: 1 mg/mL
Antigen: RALGPS1
Clonality: Polyclonal
Sequence: AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEK ARHLLDDSVL
Molecular weight: 62 kDa
Entrez gene: 100101642,417089,9649,616166,241308,100361774

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave