Home  >  Products  >  anti-Ras Association (RalGDS/AF-6) Domain Family (N-terminal) Member 7 (RASSF7) (Middle Region) antibody

anti-Ras Association (RalGDS/AF-6) Domain Family (N-terminal) Member 7 (RASSF7) (Middle Region) antibody

Cat no: ABIN406661


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Ras Association (RalGDS/AF-6) Domain Family (N-terminal) Member 7 (RASSF7) (Middle Region) antibody: This is a rabbit polyclonal antibody against RASSF7. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406661
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 8045,607151,538490
Concentration: 1 mg/mL
Antigen: RASSF7
Clonality: Polyclonal
Sequence: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQN FLVQVMGRKY
Molecular weight: 40 kDa
Entrez gene: 8045,607151,538490

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave