Home  >  Products  >  anti-Replication Factor C (Activator 1) 3, 38kDa (RFC3) (N-Term) antibody
anti-Replication Factor C (Activator 1) 3, 38kDa (RFC3) (N-Term) antibody

anti-Replication Factor C (Activator 1) 3, 38kDa (RFC3) (N-Term) antibody

Cat no: ABIN310766

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Replication Factor C (Activator 1) 3, 38kDa (RFC3) (N-Term) antibody: This is a rabbit polyclonal antibody against RFC3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN310766
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 734626,418907,5983,477308,515602,69263,288414
Concentration: 1 mg/mL
Antigen: RFC3
Clonality: Polyclonal
Sequence: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFK VVLLTEVDKL
Molecular weight: 40 kDa
Entrez gene: 734626,418907,5983,477308,515602,69263,288414

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave