Home  >  Products  >  anti-Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody
anti-Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody

anti-Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody

Cat no: ABIN183282

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Retina and Anterior Neural Fold Homeobox 2 (RAX2) (N-Term) antibody: This is a rabbit polyclonal antibody against RAXL1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183282
Reactivities: Human, Bovine, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 84839,612000
Concentration: 1 mg/mL
Antigen: RAXL1
Clonality: Polyclonal
Sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLH QLERAFEASH
Molecular weight: 20 kDa
Entrez gene: 84839,612000

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave