Home  >  Products  >  anti-Ribosomal Protein S16 (RPS16) (Middle Region) antibody
anti-Ribosomal Protein S16 (RPS16) (Middle Region) antibody

anti-Ribosomal Protein S16 (RPS16) (Middle Region) antibody

Cat no: ABIN182827

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Ribosomal Protein S16 (RPS16) (Middle Region) antibody: This is a rabbit polyclonal antibody against RPS16. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182827
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 767765,432307,6217,476463,506297,20055,140655
Concentration: 1 mg/mL
Antigen: RPS16
Clonality: Polyclonal
Sequence: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKK FGGPGARAC
Molecular weight: 44 kDa
Entrez gene: 767765,432307,6217,476463,506297,20055,140655

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave