Home  >  Products  >  anti-Ring Finger Protein 166 (RNF166) (Middle Region) antibody
anti-Ring Finger Protein 166 (RNF166) (Middle Region) antibody

anti-Ring Finger Protein 166 (RNF166) (Middle Region) antibody

Cat no: ABIN501914

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Ring Finger Protein 166 (RNF166) (Middle Region) antibody: This is a rabbit polyclonal antibody against RNF166. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN501914
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Porcine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 734843,425360,115992,614210,68718,365022
Concentration: 1 mg/mL
Antigen: RNF166
Clonality: Polyclonal
Sequence: RVVCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDY SIDEEAAFQA
Molecular weight: 26 kDa
Entrez gene: 734843,425360,115992,614210,68718,365022

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave