Home  >  Products  >  anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (N-Term) antibody
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (N-Term) antibody

anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (N-Term) antibody

Cat no: ABIN183905

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3) (N-Term) antibody: This is a rabbit polyclonal antibody against RBMS3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183905
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 767747,420661,27303,485630,784766,207181,680726
Concentration: 1 mg/mL
Antigen: RBMS3
Clonality: Polyclonal
Sequence: GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGH VISTRILRDA
Molecular weight: 46 kDa
Entrez gene: 767747,420661,27303,485630,784766,207181,680726

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave