Home  >  Products  >  anti-RNA Polymerase II TBP-Associated Factor Subunit G (TAF9) (N-Term) antibody

anti-RNA Polymerase II TBP-Associated Factor Subunit G (TAF9) (N-Term) antibody

Cat no: ABIN183030


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-RNA Polymerase II TBP-Associated Factor Subunit G (TAF9) (N-Term) antibody: This is a rabbit polyclonal antibody against TAF9. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN183030
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: ChIP, Immunohistochemistry, Immunoprecipitation, Western Blot
Size: 50 micro g
Gene: 734583,422152,6880,480815,532936,108143,373541
Concentration: 1 mg/mL
Antigen: TAF9
Clonality: Polyclonal
Sequence: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDN QMREGGVIVD
Molecular weight: 19 kDa
Entrez gene: 734583,422152,6880,480815,532936,108143,373541

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave