Home  >  Products  >  anti-RUN and FYVE Domain Containing 1 (RUFY1) (C-Term) antibody

anti-RUN and FYVE Domain Containing 1 (RUFY1) (C-Term) antibody

Cat no: ABIN502375


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-RUN and FYVE Domain Containing 1 (RUFY1) (C-Term) antibody: This is a rabbit polyclonal antibody against RUFY1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502375
Reactivities: Human, Mouse, Rat, Bovine, Chicken/Bird, Xenopus/Amphibian
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 100158302,426519,80230,528153,216724,360521
Concentration: 1 mg/mL
Antigen: RUFY1
Clonality: Polyclonal
Sequence: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPV RVCDSCHTLL
Molecular weight: 69 kDa
Entrez gene: 100158302,426519,80230,528153,216724,360521

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave