Home  >  Products  >  anti-Runt-Related Transcription Factor 2 (RUNX2) (Middle Region) antibody
anti-Runt-Related Transcription Factor 2 (RUNX2) (Middle Region) antibody

anti-Runt-Related Transcription Factor 2 (RUNX2) (Middle Region) antibody

Cat no: ABIN183389

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Runt-Related Transcription Factor 2 (RUNX2) (Middle Region) antibody: This is a rabbit polyclonal antibody against RUNX2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN183389
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 100037059,373919,860,474923,536911,12393,367218
Concentration: 1 mg/mL
Antigen: RUNX2
Clonality: Polyclonal
Sequence: YHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDRLSD LGRIPHPSMR
Molecular weight: 64 kDa
Entrez gene: 100037059,373919,860,474923,536911,12393,367218

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave