Home  >  Products  >  anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibody
anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibody

anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibody

Cat no: ABIN502919

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibody: This is a rabbit polyclonal antibody against SELENBP1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN502919
Reactivities: Human, Mouse, Rat, Bovine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 8991,510154,20341,140927
Concentration: 1 mg/mL
Antigen: SELENBP1
Clonality: Polyclonal
Sequence: MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEA PDYLATVDVD
Molecular weight: 52 kDa
Entrez gene: 8991,510154,20341,140927

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave