Home  >  Products  >  anti-Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4A (Sema4a) (N-Term) antibody

anti-Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4A (Sema4a) (N-Term) antibody

Cat no: ABIN182764


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4A (Sema4a) (N-Term) antibody: This is a rabbit polyclonal antibody against SEMA4A. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN182764
Reactivities: Human, Mouse, Rat, Canine
Hosts: Rabbit
Applications: Western Blot
Size: 100 micro g
Gene: 64218,490416,20351,310630
Concentration: 1 mg/mL
Antigen: SEMA4A
Clonality: Polyclonal
Sequence: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEK LLQKKWTTFL
Molecular weight: 84 kDa
Entrez gene: 64218,490416,20351,310630

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave