Home  >  Products  >  anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (N-Term) antibody
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (N-Term) antibody

anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (N-Term) antibody

Cat no: ABIN310777

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-serine Hydroxymethyltransferase 2 (Mitochondrial) (SHMT2) (N-Term) antibody: This is a rabbit polyclonal antibody against SHMT2. It was validated on Western Blot and immunohistochemistry.
Catalogue number: ABIN310777
Reactivities: Human, Mouse, Rat, Bovine, Canine, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunohistochemistry, Western Blot
Size: 100 micro g
Gene: 100144628,447193,6472,607458,507197,100009293,108037,299857
Concentration: 1 mg/mL
Antigen: SHMT2
Clonality: Polyclonal
Sequence: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEV VDEIELLCQR
Molecular weight: 56 kDa
Entrez gene: 100144628,447193,6472,607458,507197,100009293,108037,299857

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave