Home  >  Products  >  anti-serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2) (Middle Region) antibody

anti-serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2) (Middle Region) antibody

Cat no: ABIN406058


Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
anti-serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2) (Middle Region) antibody: This is a rabbit polyclonal antibody against SPINT2. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN406058
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Accession: O43291
Gene: 10653
Concentration: 1 mg/mL
Antigen: SPINT2
Clonality: Polyclonal
Sequence: MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVY LIRVARRNQE
Molecular weight: 28 kDa
Entrez gene: 10653

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave