Home  >  Products  >  anti-serpin Peptidase Inhibitor, Clade H (Heat Shock Protein 47), Member 1, (Collagen Binding Protein 1) (SERPINH1) (C-Term) antibody
anti-serpin Peptidase Inhibitor, Clade H (Heat Shock Protein 47), Member 1, (Collagen Binding Protein 1) (SERPINH1) (C-Term) antibody

anti-serpin Peptidase Inhibitor, Clade H (Heat Shock Protein 47), Member 1, (Collagen Binding Protein 1) (SERPINH1) (C-Term) antibody

Cat no: ABIN184193

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-serpin Peptidase Inhibitor, Clade H (Heat Shock Protein 47), Member 1, (Collagen Binding Protein 1) (SERPINH1) (C-Term) antibody: This is a rabbit polyclonal antibody against SERPINH1. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN184193
Reactivities: Human, Mouse, Rat, Bovine, Canine, Chicken/Bird, Xenopus/Amphibian, Zebrafish/Fish
Hosts: Rabbit
Applications: Immunoprecipitation, Western Blot
Size: 100 micro g
Gene: 100158395,396228,871,485187,510850,12406,29345
Concentration: 1 mg/mL
Antigen: SERPINH1
Clonality: Polyclonal
Sequence: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVR LKGDKMRDEL
Molecular weight: 46 kDa
Entrez gene: 100158395,396228,871,485187,510850,12406,29345

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave