Home  >  Products  >  anti-SET and MYND Domain Containing 3 (SMYD3) (C-Term) antibody
anti-SET and MYND Domain Containing 3 (SMYD3) (C-Term) antibody

anti-SET and MYND Domain Containing 3 (SMYD3) (C-Term) antibody

Cat no: ABIN311335

Supplier: Antibodies-online
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Read More on Supplier Website
anti-SET and MYND Domain Containing 3 (SMYD3) (C-Term) antibody: This is a rabbit polyclonal antibody against SMYD3. It was validated on Western Blot using a cell lysate as a positive control.
Catalogue number: ABIN311335
Reactivities: Human, Mouse, Rat, Bovine, Drosophila/Arthropod, Porcine
Hosts: Rabbit
Applications: Western Blot
Size: 50 micro g
Gene: 64754,100294707,616050,69726,498295
Concentration: 1 mg/mL
Antigen: SMYD3
Clonality: Polyclonal
Sequence: LHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEE CDANIRAS
Molecular weight: 42 kDa
Entrez gene: 64754,100294707,616050,69726,498295

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Antibodies-online
Get a Quote Direct from
Antibodies-online

By submitting this form you agree to your details being passed to Antibodies-online for the purpose of generating the best quote*
See Full Product Listings >
Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave